 |
 |
|
|
|
|
 |
 |
Protein Purification
Baculovirus Expression
Mammalian Expression
E. coli Expression
Molecular Biology
Products
|
Products: Kinases: PAK2KD
PAK2KD (recombinant human PAK2 kinase domain)
| Catalog #: | Size: | Concentration: | Price: |
|
| K0105S | 10 µg | 1 mg/ml | $510 |
|
| K0105M | 100 µg | 1 mg/ml | $1,970 |
|
| K0105L | 1 mg | 1 mg/ml | $7,240 |
|
| K0105B | Bulk | 1 mg/ml | Inquiry |
Sequence:
GPHMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLL
GMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRA
LYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
- The first 4 residues GPHM are from Turbo3C cleavage site.
- Phosphorylated at T402.
Component and Formulation:
PAK2KD: 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Activity:
 |
Specific activity:
85,806 pmoles/min/µg
Analysis of enzymatic activity was performed according to the Zlyte assay protocol (Invitrogen):
- Different concentrations of PAK2KD were incubated in a buffer containing 50 mM HEPES (pH7.5), 10 mM MgCl2, 1 mM EGTA, 200 mM ATP, 0.01% Brij-35, and 2 µM substrate (SER/THR 14, Invitrogen) at room temperature for 1 hour.
- Developer solution was added to the reaction and the reaction was stopped after 1 hour of incubation at room temperature.
- Fluorescence was detected using lexc=460±40 nm and lem=528±20 nm filters.
|
SDS-PAGE Analysis:
|
|
|
|
|
|
|
Privacy Policy
Tel: 858-678-8618 Fax: 888-239-6490 Toll-free: 888-365-8085
Email:
Copyright © 2025 Accelagen Inc. All rights reserved.
|
|