The Gene-to-Protein Company

Request Quote

Protein Purification

Baculovirus Expression

E. coli Expression

Molecular Biology

Products


Products: Kinases: PAK3KD

PAK3KD (recombinant human PAK3 kinase domain)

Catalog #: Size: Concentration: Price:
K0106S 10 µg 1 mg/ml $395
K0106M 100 µg 1 mg/ml $1,500
K0106L 1 mg 1 mg/ml $5,700
K0106B Bulk 1 mg/ml Inquiry


To Order: Please email PO to order@accelagen.com or fax PO to 888-239-6490


PRODUCT DETAIL DATA SHEET
Sequence:
GPHPTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMREN
KNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLG
MDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRAL
YLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR
  • The first 4 residues GPHP are from Turbo3C cleavage site.
  • Phosphorylated at T421.
Component and Formulation:

PAK3KD: 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.

Activity:

Specific activity:
18,700 pmoles/min/µg

Assay was done in a Kinase Buffer using 0.1 mg/ml PAKtide as a substrate with 20 μM ATP at 30oC for 30 min. The amount of ATP transferred was measured using Kinase-Glo reagent (Promega).

SDS-PAGE Analysis:



Protein Purification | Baculovirus Expression | Mammalian Expression | E. coli Expression | Molecular Biology | Proteins

tel: 858-678-8618     fax: 888-239-6490    toll-free: 888-365-8085     email: info@accelagen.com
Copyright © 2021 Accelagen Inc. All rights reserved.