The Gene-to-Protein Company

Request Quote

Protein Purification

Baculovirus Expression

E. coli Expression

Molecular Biology

Products


Products: Kinases: PAK7KD

PAK7KD (recombinant human PAK7 kinase domain, aka PAK5)

Catalog #: Size: Concentration: Price:
K0108S 10 µg 1 mg/ml $360
K0108M 100 µg 1 mg/ml $1,320
K0108L 1 mg 1 mg/ml $5,640
K0108B Bulk 1 mg/ml Inquiry


To Order: Please email PO to order@accelagen.com or fax PO to 888-239-6490


PRODUCT DETAIL DATA SHEET
Sequence:

GPHPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNEVVI
MRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDS
ILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQA
IRRIRDSLPPRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
  • The first 4 residues GPHP are from Turbo3C cleavage site.
  • Phosphorylated at S602.
Component and Formulation:

PAK7KD: 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.

Activity:

Specific activity:
4,199 pmoles/min/µg

Analysis of enzymatic activity was performed according to the Zlyte assay protocol (Invitrogen):

  1. Different concentrations of PAK7KD were incubated in a buffer containing 50 mM HEPES (pH7.5), 10 mM MgCl2, 1 mM EGTA, 200 mM ATP, 0.01% Brij-35, and 2 µM substrate (SER/THR 14, Invitrogen) at room temperature for 1 hour.
  2. Developer solution was added to the reaction and the reaction was stopped after 1 hour of incubation at room temperature.
  3. Fluorescence was detected using lexc=460±40 nm and lem=528±20 nm filters.
SDS-PAGE Analysis:



Protein Purification | Baculovirus Expression | Mammalian Expression | E. coli Expression | Molecular Biology | Proteins

tel: 858-678-8618     fax: 888-239-6490    toll-free: 888-365-8085     email: info@accelagen.com
Copyright © 2018 Accelagen Inc. All rights reserved.